| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 28-219 | 192 | 1-27, 220-226 | 27 | 7 | knot |
Chain Sequence |
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKRSAETR
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 29-204 | 176 | 1-28, 205-211 | 28 | 6 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Chain closureLys22 <-> Arg247 ... His129 <-> Bridging ionZn301 <-> His112 ... Lys22 |
probabilistic | |||
|
|
K +31 | Chain closureLys22 <-> Arg247 ... His129 <-> Bridging ionZn301 <-> His110 ... Lys22 |
probabilistic | |||
|
|
K +31 | Chain closureLys22 <-> Arg247 ... His112 <-> Bridging ionZn301 <-> His110 ... Lys22 |
probabilistic |
Chain Sequence |
KWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYYHTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKSINYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVIIKRSAETR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 29-223 | 195 | 1-28, 224-226 | 28 | 3 | knot | ||||
| view details |
 |
2.1 | 30-217 | 188 | 1-29 | 224-226 | 218-223 | 29 | 3 | slipknot |
| sequence length |
226
|
| structure length |
226
|
| publication title |
Structure of alpha-carbonic anhydrase from the human pathogen Helicobacter pylori.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Alpha-carbonic anhydrase
|
| source organism |
Helicobacter pylori g27
|
| total genus |
 Genus: 57
|
| ec nomenclature | |
| pdb deposition date | 2014-12-29 |
| KnotProt deposition date | 2018-10-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
