Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 16-235 | 220 | 1-15, 236-237 | 15 | 1 | slipknot |
Chain Sequence |
AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() |
+ 31 | 21-218 | 198 | 1-20, 219-222 | 20 | 4 | knot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Ala74 ... His162 <-> Bridging ionZn401 <-> His179 ... Chain closureLeu310 <-> Ala74 |
probabilistic | |||
|
K +31 | Ala74 ... His160 <-> Bridging ionZn401 <-> His179 ... Chain closureLeu310 <-> Ala74 |
probabilistic | |||
|
K +31 | Ala74 ... His160 <-> Bridging ionZn401 <-> His162 ... Chain closureLeu310 <-> Ala74 |
probabilistic |
Chain Sequence |
AWNYGEVAGPPTWKGVCATGKRQSPINIPLNTSAPKVDAEMGEFDFAYGSFEKCDVLNTGHGTMQVNFPAGNLAFIGNMELELLQFHFHAPSEHAMDGRRYAMEAHLVHKNKSTGNLAVLGIMLEPGGLIKNPALSTALEVAPEVPLAKKPSPKGINPVMLLPKKSKAGTRPFVHYPGSLTTPPCSEGVDWFVFMQPIKVPDSQILDFMRFVGDNKTYATNTRPLQLLNSRLVEYEL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 21-232 | 212 | 1-20, 233-237 | 20 | 5 | knot | ||||
view details |
![]() |
3.1 | 24-235 | 212 | 236-237 | 1-20 | 21-23 | 20 | 1 | slipknot |
sequence length |
237
|
structure length |
237
|
publication title |
Crystal Structure and Functional Characterization of Photosystem II-Associated Carbonic Anhydrase CAH3 in Chlamydomonas reinhardtii.
pubmed doi rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase, alpha type
|
source organism |
Chlamydomonas reinhardtii
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2015-01-07 |
KnotProt deposition date | 2018-10-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...