| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 29-225 | 197 | 1-28, 226-230 | 28 | 5 | knot |
Chain Sequence |
PPHWGYFGEEGPQYWGELAPEFSTCKTGKNQSPINLKPQTAVGTTSLPGFDVYYRETALKLINNGHTLQVNIPLGSYIKINGHRYELLQYHFHTPSEHQRDGFNYPMEMHLVHKDGDGNLAVIAILFQEGEENETLAKLMSFLPQTLKKQEIHESVKIHPAKFFPADKKFYKYSGSLTTPPCSEGVYWMVFKQPIQASVTQLEKMHEYLGSNARPVQRQNARTLLKSWPD
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 30-210 | 181 | 1-29, 211-215 | 29 | 5 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Pro75 ... His167 <-> Bridging ionZn401 <-> His184 ... Chain closureAsp304 <-> Pro75 |
probabilistic | |||
|
|
K +31 | Pro75 ... His165 <-> Bridging ionZn401 <-> His184 ... Chain closureAsp304 <-> Pro75 |
probabilistic | |||
|
|
K +31 | Pro75 ... His165 <-> Bridging ionZn401 <-> His167 ... Chain closureAsp304 <-> Pro75 |
probabilistic |
Chain Sequence |
PPHWGYFGEEGPQYWGELAPEFSTCKTGKNQSPINLKPQTAVGTTSLPGFDVYYRETALKLINNGHTLQVNIPLGSYIKINGHRYELLQYHFHTPSEHQRDGFNYPMEMHLVHKDGDGNLAVIAILFQEGEENETLAKLMSFLPQTLKKQEIHESVKIHPAKFFPADKKFYKYSGSLTTPPCSEGVYWMVFKQPIQASVTQLEKMHEYLGSNARPVQRQNARTLLKSWPD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 32-226 | 195 | 1-31, 227-230 | 31 | 4 | knot | ||||
| view details |
 |
2.1 | 30-223 | 194 | 1-29 | 228-230 | 224-227 | 29 | 3 | slipknot |
| sequence length |
230
|
| structure length |
230
|
| publication title |
Structural and biophysical characterization of the alpha-carbonic anhydrase from the gammaproteobacterium Thiomicrospira crunogena XCL-2: insights into engineering thermostable enzymes for CO2 sequestration.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase, alpha family
|
| source organism |
Thiomicrospira crunogena (strain xcl-2)
|
| total genus |
 Genus: 59
|
| ec nomenclature |
ec
4.2.1.1: Carbonic anhydrase. |
| pdb deposition date | 2015-02-03 |
| KnotProt deposition date | 2018-10-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
