4XZ5A

Structure of the thermostable alpha-carbonic anydrase from thiomicrospira crunogena xcl-2 gammaproteobacterium
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 29-225 197 1-28, 226-230 28 5 knot
Chain Sequence
PPHWGYFGEEGPQYWGELAPEFSTCKTGKNQSPINLKPQTAVGTTSLPGFDVYYRETALKLINNGHTLQVNIPLGSYIKINGHRYELLQYHFHTPSEHQRDGFNYPMEMHLVHKDGDGNLAVIAILFQEGEENETLAKLMSFLPQTLKKQEIHESVKIHPAKFFPADKKFYKYSGSLTTPPCSEGVYWMVFKQPIQASVTQLEKMHEYLGSNARPVQRQNARTLLKSWPD
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 30-210 181 1-29, 211-215 29 5 knot
Fingerprint Knot forming loop Loop type
K +31 Pro75 ... His167 <->
Bridging ionZn401
<-> His184 ...
Chain closureAsp304 <-> Pro75
probabilistic
K +31 Pro75 ... His165 <->
Bridging ionZn401
<-> His184 ...
Chain closureAsp304 <-> Pro75
probabilistic
K +31 Pro75 ... His165 <->
Bridging ionZn401
<-> His167 ...
Chain closureAsp304 <-> Pro75
probabilistic
Chain Sequence
PPHWGYFGEEGPQYWGELAPEFSTCKTGKNQSPINLKPQTAVGTTSLPGFDVYYRETALKLINNGHTLQVNIPLGSYIKINGHRYELLQYHFHTPSEHQRDGFNYPMEMHLVHKDGDGNLAVIAILFQEGEENETLAKLMSFLPQTLKKQEIHESVKIHPAKFFPADKKFYKYSGSLTTPPCSEGVYWMVFKQPIQASVTQLEKMHEYLGSNARPVQRQNARTLLKSWPD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 32-226 195 1-31, 227-230 31 4 knot
view details
2.1 30-223 194 1-29 228-230 224-227 29 3 slipknot
sequence length 230
structure length 230
publication title Structural and biophysical characterization of the alpha-carbonic anhydrase from the gammaproteobacterium Thiomicrospira crunogena XCL-2: insights into engineering thermostable enzymes for CO2 sequestration.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase, alpha family
source organism Thiomicrospira crunogena (strain xcl-2)
total genus Genus: 59
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2015-02-03
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
4G7AA 6EKIA 4C3TA 4COQA 4UOVA
similar chains in the KnotProt database (40% sequence similarity)
6IM0A 6IM1A 6IM3A 8W7XA
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
4G7A A; 6EKI A; 
#similar chains, but unknotted
4UOV A; 
#similar chains in the pdb database (40% sequence similarity)
6IM0 A; 6IM1 A; 6IM3 A; 8W7X A; 

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.