4YCGC

Pro-bone morphogenetic protein 9
Cysteine knot
Loop Piercing
view details
334-c-338-b-406-c-404 305-b-371
Chain Sequence
GSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
sequence length 106
structure length 106
publication title Structure of bone morphogenetic protein 9 procomplex.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Bone Morphogenetic Protein 9 Growth Factor Domain
source organism Mus musculus
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.