| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 334-c-338-b-406-c-404 | 305-b-371 |
Chain Sequence |
GSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
|
| sequence length |
106
|
| structure length |
106
|
| publication title |
Structure of bone morphogenetic protein 9 procomplex.
pubmed doi rcsb |
| molecule tags |
Cytokine
|
| molecule keywords |
Bone Morphogenetic Protein 9 Growth Factor Domain
|
| source organism |
Mus musculus
|
| ec nomenclature | |
| pdb deposition date | 2015-02-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
