| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 90-134 | 45 | 1-89, 135-249 | 89 | 115 | knot |
Chain Sequence |
RGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLG----------ADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHN
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 90-135 | 46 | 1-89, 136-239 | 89 | 104 | knot | ||||
| view details |
|
 |
2.1 | 92-192 | 101 | 1-89, 208-239 | 90-91, 193-207 | 89 | 32 | slipknot |
| sequence length |
249
|
| structure length |
239
|
| publication title |
Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb |
| molecule tags |
Transferase/transferase inhibitor
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
|
| missing residues |
166-175
|
| total genus |
 Genus: 74
|
| ec nomenclature | |
| pdb deposition date | 2015-03-13 |
| KnotProt deposition date | 2016-03-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
