| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 88-132 | 45 | 1-87, 133-248 | 87 | 116 | knot |
Chain Sequence |
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 88-135 | 48 | 1-87, 136-240 | 87 | 105 | knot | ||||
| view details |
|
3.1 | 86-133 | 48 | 1-85 | 150-240 | 134-149 | 85 | 91 | slipknot |
| sequence length |
248
|
| structure length |
240
|
| publication title |
Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb |
| molecule tags |
Transferase/transferase inhibitor
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
|
| missing residues |
164-171
|
| total genus |
 Genus: 74
|
| ec nomenclature | |
| pdb deposition date | 2015-03-13 |
| KnotProt deposition date | 2016-03-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
