Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 89-132 | 44 | 1-88, 133-248 | 88 | 116 | knot |
Chain Sequence |
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGV---------DSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 88-133 | 46 | 1-87, 134-239 | 87 | 106 | knot | ||||
view details |
![]() |
2.1 | 86-131 | 46 | 1-85 | 137-239 | 132-136 | 85 | 103 | slipknot | ||
view details |
|
![]() |
2.1 | 90-212 | 123 | 1-87, 219-239 | 88-89, 213-218 | 87 | 21 | slipknot | ||
view details |
|
![]() |
2.1 | 90-218 | 129 | 1-87, 237-239 | 88-89, 219-236 | 87 | 3 | slipknot |
sequence length |
248
|
structure length |
239
|
publication title |
Structural basis for methyl-donor-dependent and sequence-specific binding to tRNA substrates by knotted methyltransferase TrmD.
pubmed doi rcsb |
molecule tags |
Transferase/rna
|
molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
source organism |
Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
|
missing residues |
162-170
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase. |
pdb deposition date | 2015-03-20 |
KnotProt deposition date | 2015-12-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...