4ZQYC

Ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot

  Help Cysteine knot data interpretation Full screen
Loop Piercing
view details
3-c-17-b-42-c-24 3-b-17
Chain Sequence
RLCLSDYSIFSETIEICPEGHNYCFKKFPKGITRLPWVIRGCAATCPKPEAQVYVDCCARDKCNR
sequence length 65
structure length 65
publication title Ringhalexin from Hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Ringhalexin
ec nomenclature
pdb deposition date 2015-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling