4ZQYC

Ringhalexin from hemachatus haemachatus: a novel inhibitor of extrinsic tenase complex
Cysteine knot
Loop Piercing
view details
3-c-17-b-42-c-24 3-b-17
Chain Sequence
RLCLSDYSIFSETIEICPEGHNYCFKKFPKGITRLPWVIRGCAATCPKPEAQVYVDCCARDKCNR
sequence length 65
structure length 65
publication title Ringhalexin from Hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Ringhalexin
ec nomenclature
pdb deposition date 2015-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling