| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 77-141 | 65 | 1-76 | 146-158 | 142-145 | 76 | 13 | slipknot |
Chain Sequence |
RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 79-139 | 61 | 1-78 | 147-158 | 140-146 | 78 | 12 | slipknot | ||
| view details |
|
1.1 | 82-140 | 59 | 1-78, 145-158 | 79-81, 141-144 | 78 | 14 | slipknot | |||
| view details |
|
1.1 | 82-144 | 63 | 1-78, 147-158 | 79-81, 145-146 | 78 | 12 | slipknot |
| sequence length |
158
|
| structure length |
158
|
| publication title |
Ebola Viral Glycoprotein Bound to Its Endosomal Receptor Niemann-Pick C1
doi rcsb |
| molecule tags |
Viral protein/transport protein
|
| molecule keywords |
GP1
|
| source organism |
Zaire ebolavirus
|
| total genus |
Genus: 31
|
| ec nomenclature | |
| pdb deposition date | 2015-11-30 |
| KnotProt deposition date | 2016-01-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...