5GRAA

Crystal structure of trmj from z. mobilis zm4
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 78-127 50 1-77, 128-232 77 105 knot
Chain Sequence
AVPAIILVRPQLGENIGKAARAMLNFGLDDLRLVAPRDGWPNPSAGPAASGADRVLQQARVFPTVAEAVADCAHVYATTVRKRGVTKPVMTPEQAAQTIHEQEGGVGILFGPERAGLETDDVALARTIITVPVNPEFSSLNLAQAVILVAYEWSKGQ--------DMEPPAPQEELEAMIGHLENMLDKNGYFFPIPRIPTIKRTLRTLLTKPSWNSMEIRTLRGVLSTLEK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-129 53 1-76, 130-224 76 95 knot
view details
2.1 68-126 59 1-25, 130-224 26-67, 127-129 25 95 slipknot
view details
2.1 79-208 130 1-76, 219-224 77-78, 209-218 76 6 slipknot
sequence length 232
structure length 224
publication title An asymmetric dimeric structure of TrmJ tRNA methyltransferase from Zymomonas mobilis with a flexible C-terminal dimer
pubmed doi rcsb
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
source organism Zymomonas mobilis subsp. mobilis zm4 = atcc 31821
missing residues 158-165
total genus Genus: 70
ec nomenclature
pdb deposition date 2016-08-09
KnotProt deposition date 2017-06-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling