| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-255 | 232 | 1-23, 256-259 | 23 | 4 | knot |
Chain Sequence |
SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVVFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVVKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 25-255 | 231 | 1-24, 256-259 | 24 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Ser2 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureLys260 <-> Ser2 |
probabilistic | |||
|
|
K +31 | Chain closureSer2 <-> Lys260 ... His119 <-> Bridging ionZn301 <-> His96 ... Ser2 |
probabilistic | |||
|
|
K +31 | Ser2 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> Ser2 |
probabilistic |
Chain Sequence |
SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVVFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVVKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-258 | 233 | 1-25, 259-259 | 25 | 1 | knot | ||||
| view details |
 |
2.1 | 27-253 | 227 | 1-26 | 259-259 | 254-258 | 26 | 1 | slipknot |
| sequence length |
259
|
| structure length |
259
|
| publication title |
Metalacarborane inhibitors of Carbonic Anhydrase IX
rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 80
|
| ec nomenclature | |
| pdb deposition date | 2017-07-13 |
| KnotProt deposition date | 2018-10-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
