| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 20-67 | 48 | 1-19, 68-90 | 19 | 23 | knot |
Chain Sequence |
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPSTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 17-70 | 54 | 1-16, 71-90 | 16 | 20 | knot | ||||
| view details |
|
3.1m | 18-74 | 57 | 1-16, 89-90 | 17-17, 75-88 | 16 | 2 | slipknot |
| sequence length |
90
|
| structure length |
90
|
| publication title |
Crystal structure of human PHF5A
rcsb |
| molecule tags |
Transcription
|
| molecule keywords |
PHD finger-like domain-containing protein 5A
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 14
|
| ec nomenclature | |
| pdb deposition date | 2016-08-10 |
| KnotProt deposition date | 2016-09-09 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
