| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 17-254 | 238 | 1-16, 255-257 | 16 | 3 | knot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDCGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-253 | 232 | 1-21, 254-257 | 21 | 4 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureLys260 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureLys260 <-> His4 |
probabilistic |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDCGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 24-256 | 233 | 1-23, 257-257 | 23 | 1 | knot | ||||
| view details |
 |
2.1 | 24-251 | 228 | 1-23 | 257-257 | 252-256 | 23 | 1 | slipknot | ||
| view details |
|
3.1 | 25-255 | 231 | 256-257 | 1-23 | 24-24 | 23 | 1 | slipknot |
| sequence length |
257
|
| structure length |
257
|
| publication title |
A Predictive Approach for the Optical Control of Carbonic Anhydrase II Activity.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 78
|
| ec nomenclature | |
| pdb deposition date | 2016-09-02 |
| KnotProt deposition date | 2018-10-18 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
