| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 26-253 | 228 | 1-25, 254-257 | 25 | 4 | knot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFCKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
3.1 | 24-256 | 233 | 1-23, 257-257 | 23 | 1 | knot | ||||
| view details |
|
2.1 | 25-251 | 227 | 1-24 | 257-257 | 252-256 | 24 | 1 | slipknot | ||
| view details |
|
2.1 | 28-255 | 228 | 256-257 | 1-25 | 26-27 | 25 | 1 | slipknot |
| sequence length |
257
|
| structure length |
257
|
| publication title |
A rational approach for the optical control of carbonic anhydrase II activity
rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
Genus: 77
|
| ec nomenclature | |
| pdb deposition date | 2016-09-02 |
| KnotProt deposition date | 2017-09-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...