
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 73-121 | 49 | 1-72, 122-157 | 72 | 36 | knot |
Chain Sequence |
HHVKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 72-123 | 52 | 1-71, 124-157 | 71 | 34 | knot | ||||
view details |
![]() |
2.1 | 70-119 | 50 | 1-69 | 125-157 | 120-124 | 69 | 33 | slipknot | ||
view details |
![]() |
3.1 | 73-123 | 51 | 124-157 | 1-71 | 72-72 | 71 | 33 | slipknot |
sequence length |
157
|
structure length |
157
|
publication title |
Small methyltransferase RlmH assembles a composite active site to methylate a ribosomal pseudouridine.
pubmed doi rcsb |
molecule tags |
Transferase/antibiotic
|
molecule keywords |
Ribosomal RNA large subunit methyltransferase H
|
source organism |
Escherichia coli
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-11-14 |
KnotProt deposition date | 2017-05-03 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...