
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 14-62 | 49 | 1-13, 63-85 | 13 | 23 | knot |
Chain Sequence |
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 14-80 | 67 | 1-13, 81-85 | 13 | 5 | knot | ||||
view details |
![]() |
3.1m | 13-64 | 52 | 1-12 | 81-85 | 65-80 | 12 | 5 | slipknot |
sequence length |
85
|
structure length |
85
|
publication title |
Structure of the human activated spliceosome in three conformational states.
pubmed doi rcsb |
molecule tags |
Splicing
|
molecule keywords |
Pre-mRNA-processing-splicing factor 8
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2018-01-17 |
KnotProt deposition date | 2018-09-25 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...