
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 14-63 | 50 | 1-13, 64-85 | 13 | 22 | knot |
Chain Sequence |
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
|
![]() |
- 31 | 10-58 | 49 | 1-9, 59-76 | 9 | 18 | knot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K -31 | Cys11 ... Cys85 <-> Bridging ionZn202 <-> Cys11 |
ion-based | |||
|
K -31 | Cys11 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Cys85 <-> Bridging ionZn202 <-> Cys11 |
ion-based | |||
|
K -31 | Cys11 ... Cys30 <-> Bridging ionZn203 <-> Cys33 ... Cys85 <-> Bridging ionZn202 <-> Cys11 |
ion-based | |||
|
K -31 | Cys11 <-> Bridging ionZn202 <-> Cys85 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Cys11 |
ion-based | |||
|
K -31 | Asp7 ... Cys72 <-> Bridging ionZn203 <-> Cys75 ... Chain closureLeu91 <-> Asp7 |
probabilistic | |||
|
K -31 | Asp7 ... Cys30 <-> Bridging ionZn203 <-> Cys33 ... Chain closureLeu91 <-> Asp7 |
probabilistic | |||
|
K -31 | Chain closureAsp7 <-> Leu91 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Asp7 |
probabilistic | |||
|
K -31 | Cys11 <-> Bridging ionZn202 <-> Cys85 ... Cys75 <-> Bridging ionZn203 <-> Cys72 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Cys11 |
ion-based | |||
|
K -31 | Cys11 <-> Bridging ionZn202 <-> Cys85 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Cys33 <-> Bridging ionZn203 <-> Cys30 ... Cys11 |
ion-based | |||
|
K -31 | Chain closureAsp7 <-> Leu91 ... Cys75 <-> Bridging ionZn203 <-> Cys72 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Asp7 |
probabilistic | |||
|
K -31 | Chain closureAsp7 <-> Leu91 ... Cys61 <-> Bridging ionZn201 <-> Cys58 ... Cys33 <-> Bridging ionZn203 <-> Cys30 ... Asp7 |
probabilistic |
Chain Sequence |
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 13-66 | 54 | 1-12, 67-85 | 12 | 19 | knot |
sequence length |
85
|
structure length |
85
|
publication title |
The cryo-EM structure of the SF3b spliceosome complex bound to a splicing modulator reveals a pre-mRNA substrate competitive mechanism of action
pubmed doi rcsb |
molecule tags |
Splicing
|
molecule keywords |
Splicing factor 3B subunit 5
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2018-05-23 |
KnotProt deposition date | 2018-10-20 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...