
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 45-90 | 46 | 1-44, 91-184 | 44 | 94 | knot |
Chain Sequence |
MIPRVFIYRLPQDDPRKNTAIKLVRFGFAQLVDSIKALPSGSIILDPTVKTPLTPSDRVIAESRGLSLIDCSWKRAVDVHTKFIRGKFIRRRLPLLIAANPTHYGKPYILSTIEAVAAALYIMGFKDEAMEVLRLYKWGPNFIIINQKYLERYAAGDLSPERELLGVDDVDNGLEQLMRVLTNG
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 44-91 | 48 | 1-43, 92-184 | 43 | 93 | knot | ||||
view details |
![]() |
3.1 | 46-112 | 67 | 1-43, 123-184 | 44-45, 113-122 | 43 | 62 | slipknot |
sequence length |
184
|
structure length |
184
|
publication title |
Ribosome Biogenesis Factor Tsr3 is the Aminocarboxypropyl Transferase Responsible for 18S Rrna Hypermodification in Yeast and Humans
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
TSR3
|
source organism |
Vulcanisaeta distributa
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2015-09-15 |
KnotProt deposition date | 2016-04-27 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...