5ARJA

Crystal structure of porcine rnase 4 d80a mutant
Cysteine knot
Loop Piercing
view details
39-c-57-b-107-c-92 25-b-81
Chain Sequence
MQDRMYQRFLRQHVDPDATGGNDAYCNLMMQRRKMTSHYCKRFNTFIHEDIWNIRSICSTSNIQCKNGQMNCHEGVVKVTACRETGSSRAPNCRYRAMASTRRVVIACEGNPEVPVHFDK
sequence length 120
structure length 120
publication title Structural Basis of Substrate Specificity in Porcine Rnase 4.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords RIBONUCLEASE 4
source organism Sus scrofa
ec nomenclature
pdb deposition date 2015-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling