Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 39-c-55-b-110-c-96 | 65-b-126 |
Chain Sequence |
IMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNSGTETSQVA
|
sequence length |
111
|
structure length |
111
|
publication title |
Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
molecule keywords |
Norrin
|
source organism |
Homo sapiens
|
ec nomenclature | |
pdb deposition date | 2015-05-28 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...