5BU6A

Structure of bpsb deaceylase domain from bordetella bronchiseptica
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-260 254 1-6, 261-264 6 3 slipknot
Chain Sequence
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 13-186 174 1-12, 187-191 12 5 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closurePro35 <-> Asn298
... His189 <->
Bridging ionNi401
<-> Asp114 ... Pro35
probabilistic
K +31 Pro35 ... His184 <->
Bridging ionNi401
<-> His189 ...
Chain closureAsn298 <-> Pro35
probabilistic
K +31 Pro35 ... Asp114 <->
Bridging ionNi401
<-> His184 ...
Chain closureAsn298 <-> Pro35
probabilistic
Chain Sequence
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 7-261 255 1-6, 262-264 6 3 knot
publication title The Protein BpsB Is a Poly-beta-1,6-N-acetyl-d-glucosamine Deacetylase Required for Biofilm Formation in Bordetella bronchiseptica.
pubmed doi rcsb
structure length 264
molecule tags Hydrolase
source organism Bordetella bronchiseptica rb50
sequence length 264
total genus Genus: 78
molecule keywords BpsB (PgaB), Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
ec nomenclature ec 3.5.1.33: N-acetylglucosamine deacetylase.
pdb deposition date 2015-06-03
KnotProt deposition date 2018-10-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling