
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 8-262 | 255 | 263-264 | 1-1 | 2-7 | 1 | 1 | slipknot |
Chain Sequence |
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
|
![]() |
+ 31 | 12-192 | 181 | 1-11, 193-196 | 11 | 4 | knot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Pro35 ... Asp114 <-> Bridging ionNi401 <-> His184 ... Chain closureAsn298 <-> Pro35 |
probabilistic | |||
|
K +31 | Chain closurePro35 <-> Asn298 ... His189 <-> Bridging ionNi401 <-> His184 ... Pro35 |
probabilistic | |||
|
K +31 | Pro35 ... Asp114 <-> Bridging ionNi401 <-> His189 ... Chain closureAsn298 <-> Pro35 |
probabilistic |
Chain Sequence |
PDPDDGLTFRVLSMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNPISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLAAFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSAHLIRHHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVALTQIRRSLVDYEVN
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 7-261 | 255 | 1-6, 262-264 | 6 | 3 | knot | ||||
view details |
![]() |
2.1 | 7-258 | 252 | 1-6 | 262-264 | 259-261 | 6 | 3 | slipknot |
sequence length |
264
|
structure length |
264
|
publication title |
The Protein BpsB Is a Poly-beta-1,6-N-acetyl-d-glucosamine Deacetylase Required for Biofilm Formation in Bordetella bronchiseptica.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
BpsB (PgaB), Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
|
source organism |
Bordetella bronchiseptica rb50
|
ec nomenclature |
ec
3.5.1.33: N-acetylglucosamine deacetylase. |
pdb deposition date | 2015-06-03 |
KnotProt deposition date | 2018-10-20 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...