5C50B

Crystal structure of the complex of human atg101-atg13 horma domain
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 86-167 82 1-74, 172-185 75-85, 168-171 74 14 slipknot
Chain Sequence
SDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 88-162 75 1-72, 177-185 73-87, 163-176 72 9 slipknot
sequence length 185
structure length 185
publication title Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Autophagy-related protein 101
source organism Homo sapiens
total genus Genus: 46
ec nomenclature
pdb deposition date 2015-06-19
KnotProt deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
None 5XUYA 5XV1A 5XV3A 5XV4A 5XV6A
similar chains in the KnotProt database (40% sequence similarity)
8DO8B
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)

#similar chains, but unknotted
5XV6 A; 
#similar chains in the pdb database (40% sequence similarity)
8DO8 B; 

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.