Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 86-167 | 82 | 1-74, 172-185 | 75-85, 168-171 | 74 | 14 | slipknot |
Chain Sequence |
SDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 88-162 | 75 | 1-72, 177-185 | 73-87, 163-176 | 72 | 9 | slipknot |
sequence length |
185
|
structure length |
185
|
publication title |
Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex.
pubmed doi rcsb |
molecule tags |
Protein binding
|
molecule keywords |
Autophagy-related protein 101
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2015-06-19 |
KnotProt deposition date | 2015-10-15 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...