5C69A

Crystal structure of prefusion-stabilized rsv f variant pr-dm
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 142
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-238 214 1-24 244-453 239-243 24 210 slipknot
Chain Sequence
NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPAT------FLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFI
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 31-234 204 1-30 247-453 235-246 30 207 slipknot
sequence length 453
structure length 447
publication title A highly stable prefusion RSV F vaccine derived from structural analysis of the fusion mechanism.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Fusion glycoprotein F0,Fibritin
source organism Human respiratory syncytial virus a
missing residues 78-83
total genus Genus: 142
ec nomenclature
pdb deposition date 2015-06-22
KnotProt deposition date 2018-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00523 Fusion_gly Fusion glycoprotein F0
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling