
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 25-254 | 230 | 1-24, 255-266 | 24 | 12 | knot |
Chain Sequence |
HWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTT
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
|
![]() |
+ 31 | 24-254 | 231 | 1-23, 255-266 | 23 | 12 | knot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Thr269 <-> His4 |
probabilistic | |||
|
K +31 | His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Thr269 <-> His4 |
probabilistic | |||
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Thr269 <-> His4 |
probabilistic |
Chain Sequence |
HWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTT
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 26-258 | 233 | 1-25, 259-267 | 25 | 9 | knot | ||||
view details |
![]() |
2.1 | 25-253 | 229 | 1-24 | 259-267 | 254-258 | 24 | 9 | slipknot |
sequence length |
267
|
structure length |
267
|
publication title |
Discovery of 1,1'-Biphenyl-4-sulfonamides as a New Class of Potent and Selective Carbonic Anhydrase XIV Inhibitors.
pubmed doi rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase 14
|
source organism |
Homo sapiens
|
total genus |
![]() |
ec nomenclature |
ec
4.2.1.1: Carbonic anhydrase. |
pdb deposition date | 2015-07-14 |
KnotProt deposition date | 2018-10-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...