| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 82-120 | 39 | 1-81, 121-152 | 81 | 32 | knot |
Chain Sequence |
GPHMLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLKRAGLDYWPHVDLRLHDSFAAFLEALPRGARVFAFSARGEASLYEARFREGDYLLFGPESRGLPEEVLARFPTLKIPMPGPVRSLNLAVAVGVAAYEAYRQLTGR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 81-123 | 43 | 1-80, 124-152 | 80 | 29 | knot | ||||
| view details |
 |
2.1 | 80-118 | 39 | 1-79 | 124-152 | 119-123 | 79 | 29 | slipknot | ||
| view details |
|
2.1 | 83-123 | 41 | 124-152 | 1-80 | 81-82 | 80 | 28 | slipknot |
| sequence length |
152
|
| structure length |
152
|
| publication title |
Structural insights into the 2-OH methylation of C34 or U34 on tRNA
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
Putative tRNA (cytidine(34)-2'-O)-methyltransferase
|
| source organism |
Thermus thermophilus hb27
|
| total genus |
 Genus: 44
|
| ec nomenclature | |
| pdb deposition date | 2015-07-19 |
| KnotProt deposition date | 2016-07-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
