5E13A

Crystal structure of eosinophil-derived neurotoxin in complex with the triazole double-headed ribonucleoside 11c
Cysteine knot
Loop Piercing
view details
37-c-55-b-111-c-96 23-b-83
Chain Sequence
MKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
sequence length 135
structure length 135
publication title Triazole double-headed ribonucleosides as inhibitors of eosinophil derived neurotoxin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Non-secretory ribonuclease
source organism Homo sapiens
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2015-09-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling