5E4RA

Crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31 41
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 225-349 125 1-203, 406-475 204-224, 350-405 203 70 slipknot
view details
41 196-405 210 1-195, 406-475 195 70 knot
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFRGM---------LFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFRGM
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
4.1 192-404 213 1-191, 405-466 191 62 knot
view details
3.2 187-391 205 1-186 407-466 392-406 186 60 slipknot
view details
3.2 202-421 220 1-191, 445-466 192-201, 422-444 191 22 slipknot
view details
3.2 202-444 243 1-191, 451-466 192-201, 445-450 191 16 slipknot
view details
2.3 202-387 186 1-189, 404-466 190-201, 388-403 189 63 slipknot
view details
2.3 202-403 202 1-189, 406-466 190-201, 404-405 189 61 slipknot
view details
3.2 203-425 223 1-201, 445-466 202-202, 426-444 201 22 slipknot
view details
3.2 203-444 242 1-201, 451-466 202-202, 445-450 201 16 slipknot
view details
3.2 203-450 248 1-191, 452-466 192-202, 451-451 191 15 slipknot
view details
2.1 213-346 134 1-194, 366-466 195-212, 347-365 194 101 slipknot
view details
2.1 214-344 131 1-197, 362-466 198-213, 345-361 197 105 slipknot
view details
3.1 223-347 125 1-210, 368-466 211-222, 348-367 210 99 slipknot
view details
3.1 223-367 145 1-210, 371-466 211-222, 368-370 210 96 slipknot
view details
1.1 230-333 104 1-214, 349-466 215-229, 334-348 214 118 slipknot
view details
1.1 233-389 157 1-218, 407-466 219-232, 390-406 218 60 slipknot
missing residues 329-337
publication title Artificial domain duplication replicates evolutionary history of ketol-acid reductoisomerases
doi rcsb
structure length 466
molecule tags Oxidoreductase
source organism Ignisphaera aggregans (strain dsm 17230 / jcm 13409 / aq1.s1)
sequence length 475
total genus Genus: 208
molecule keywords Ketol-acid reductoisomerase
ec nomenclature
pdb deposition date 2015-10-07
KnotProt deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling