| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-22-c-17 | 16-b-29 |
Chain Sequence |
DCLGMFKSCDPENDKCCKRLVCSRSHRWCKWKL
|
| sequence length |
33
|
| structure length |
33
|
| publication title |
Engineering Highly Potent and Selective Microproteins against Nav1.7 Sodium Channel for Treatment of Pain.
pubmed doi rcsb |
| molecule tags |
Toxin/immune system
|
| molecule keywords |
Antibody Fab fragment heavy chain
|
| source organism |
Mus musculus
|
| ec nomenclature | |
| pdb deposition date | 2015-11-11 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
