Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 40-c-58-b-110-c-95 | 26-b-84 |
Chain Sequence |
KETAAAHFEHQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
sequence length |
124
|
structure length |
124
|
publication title |
Molecular insight into a RNase A p2 subsite double mutant reveals local changes that explain its different catalytic efficieny with respect to the native enzyme
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
Ribonuclease pancreatic
|
source organism |
Bos taurus
|
ec nomenclature | |
pdb deposition date | 2015-11-17 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...