5EW5A

Crystal structure of colicin e9 in complex with its immunity protein im9
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 114-187 74 1-113 202-496 188-201 113 295 slipknot
Chain Sequence
AAPVAFGFPALSTPGAGGLAVSISASELSAAIAGIIAKLKK------PFGVVLSSLIPSEIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNDSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNCERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKCAMESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELHHDKPISQGGEVYDMDNIRVTTPKRHIDIHR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 24-183 160 1-9, 196-490 10-23, 184-195 9 295 slipknot
view details
3.1 68-181 114 1-48, 196-490 49-67, 182-195 48 295 slipknot
view details
1.1 102-190 89 1-95, 198-490 96-101, 191-197 95 293 slipknot
view details
3.1 106-182 77 1-97, 194-490 98-105, 183-193 97 297 slipknot
view details
3.1 106-193 88 1-101, 195-490 102-105, 194-194 101 296 slipknot
view details
3.1 107-182 76 1-105, 194-490 106-106, 183-193 105 297 slipknot
sequence length 496
structure length 490
publication title Structural and biophysical analysis of nuclease protein antibiotics.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Colicin-E9
source organism Escherichia coli
missing residues 42-47
total genus Genus: 156
ec nomenclature
pdb deposition date 2015-11-20
KnotProt deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling