5F1BA

Structural basis of ebola virus entry: viral glycoprotein bound to its endosomal receptor niemann-pick c1
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 77-141 65 1-76 146-158 142-145 76 13 slipknot
Chain Sequence
RSIPLGVIHNSVLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 79-139 61 1-78 147-158 140-146 78 12 slipknot
view details
1.1 82-140 59 1-78, 145-158 79-81, 141-144 78 14 slipknot
view details
1.1 82-144 63 1-78, 147-158 79-81, 145-146 78 12 slipknot
publication title Ebola Viral Glycoprotein Bound to Its Endosomal Receptor Niemann-Pick C1
doi rcsb
structure length 158
molecule tags Viral protein/transport protein
source organism Zaire ebolavirus
sequence length 158
total genus Genus: 31
molecule keywords GP1
ec nomenclature
pdb deposition date 2015-11-30
KnotProt deposition date 2016-01-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling