5F3BC

Structure of myostatin in complex with chimeric rk35 antibody
Cysteine knot
Loop Piercing
view details
43-c-47-b-108-c-106 15-b-74
Chain Sequence
DFGLDCDEE---SRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
sequence length 109
structure length 106
publication title Beyond CDR-grafting: Structure-guided humanization of framework and CDR regions of an anti-myostatin antibody.
pubmed doi rcsb
molecule tags Signaling protein/immune system
molecule keywords RK35 Chimeric antibody heavy chain
source organism Mus musculus
missing residues 9-11
ec nomenclature
pdb deposition date 2015-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.