| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 43-c-47-b-108-c-106 | 15-b-74 |
Chain Sequence |
FGLDCDES----RCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
|
| sequence length |
108
|
| structure length |
104
|
| publication title |
Beyond CDR-grafting: Structure-guided humanization of framework and CDR regions of an anti-myostatin antibody.
pubmed doi rcsb |
| molecule tags |
Signaling protein/immune system
|
| molecule keywords |
humanized RK35 antibody heavy chain
|
| source organism |
Mus musculus
|
| missing residues |
8-11
|
| ec nomenclature | |
| pdb deposition date | 2015-12-02 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
