| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 8-c-15-b-26-c-22 | 21-b-31 |
Chain Sequence |
GLIESIACIQKGLPCMEHSDCCRGVCEALFCQ
|
| sequence length |
32
|
| structure length |
32
|
| publication title |
Characterization of Three Venom Peptides from the Spitting Spider Scytodes Thoracica.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Venom peptide U3-SYTX-Sth1a
|
| source organism |
Scytodes thoracica
|
| ec nomenclature | |
| pdb deposition date | 2016-03-15 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
