
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 19-68 | 50 | 1-18, 69-103 | 18 | 35 | knot |
Chain Sequence |
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 19-71 | 53 | 1-18, 72-103 | 18 | 32 | knot |
sequence length |
103
|
structure length |
103
|
publication title |
Structure of a yeast activated spliceosome at 3.5 angstrom resolution
pubmed doi rcsb |
molecule tags |
Rna binding protein/rna
|
molecule keywords |
Pre-mRNA-splicing factor 8
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-07-12 |
KnotProt deposition date | 2016-10-22 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...