| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 82-135 | 54 | 1-81, 136-170 | 81 | 35 | knot |
Chain Sequence |
QSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 80-136 | 57 | 1-79, 137-170 | 79 | 34 | knot | ||||
| view details |
 |
3.1 | 81-137 | 57 | 138-170 | 1-79 | 80-80 | 79 | 32 | slipknot |
| sequence length |
170
|
| structure length |
170
|
| publication title |
Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruiginosa
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
|
| source organism |
Pseudomonas aeruginosa
|
| total genus |
 Genus: 60
|
| ec nomenclature | |
| pdb deposition date | 2016-07-13 |
| KnotProt deposition date | 2016-10-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
