| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 85-139 | 55 | 1-84, 140-174 | 84 | 35 | knot |
Chain Sequence |
NLYFQSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 85-140 | 56 | 1-84, 141-174 | 84 | 34 | knot | ||||
| view details |
 |
2.1 | 81-136 | 56 | 1-80 | 143-174 | 137-142 | 80 | 32 | slipknot | ||
| view details |
|
3.1 | 86-160 | 75 | 1-84, 167-174 | 85-85, 161-166 | 84 | 8 | slipknot | |||
| view details |
|
2.1 | 86-167 | 82 | 168-174 | 1-84 | 85-85 | 84 | 6 | slipknot |
| sequence length |
174
|
| structure length |
174
|
| publication title |
Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruiginosa
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
|
| source organism |
Pseudomonas aeruginosa
|
| total genus |
 Genus: 60
|
| ec nomenclature | |
| pdb deposition date | 2016-07-13 |
| KnotProt deposition date | 2016-10-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
