| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 78-127 | 50 | 1-77, 128-232 | 77 | 105 | knot |
Chain Sequence |
AVPAIILVRPQLGENIGKAARAMLNFGLDDLRLVAPRDGWPNPSAGPAASGADRVLQQARVFPTVAEAVADCAHVYATTVRKRGVTKPVMTPEQAAQTIHEQEGGVGILFGPERAGLETDDVALARTIITVPVNPEFSSLNLAQAVILVAYEWSKGQ--------DMEPPAPQEELEAMIGHLENMLDKNGYFFPIPRIPTIKRTLRTLLTKPSWNSMEIRTLRGVLSTLEK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 77-129 | 53 | 1-76, 130-224 | 76 | 95 | knot | ||||
| view details |
 |
2.1 | 68-126 | 59 | 1-25, 130-224 | 26-67, 127-129 | 25 | 95 | slipknot | |||
| view details |
|
|
2.1 | 79-208 | 130 | 1-76, 219-224 | 77-78, 209-218 | 76 | 6 | slipknot |
| sequence length |
232
|
| structure length |
224
|
| publication title |
An asymmetric dimeric structure of TrmJ tRNA methyltransferase from Zymomonas mobilis with a flexible C-terminal dimer
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
|
| source organism |
Zymomonas mobilis subsp. mobilis zm4 = atcc 31821
|
| missing residues |
158-165
|
| total genus |
 Genus: 70
|
| ec nomenclature | |
| pdb deposition date | 2016-08-09 |
| KnotProt deposition date | 2017-06-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
