5GS6A

Full-length ns1 structure of zika virus from 2015 brazil strain
Slipknot S +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 87-149 63 150-352 1-39 40-86 39 202 slipknot
Chain Sequence
HVGCSVDFSKKETRCGTGVFVYNDVEAWRDRYKYHPDSPRRLAAAVKQAWEDGICGISSVSRMENIMWRSVEGELNAILEENGVQLTVVVGSVKNPMWRGPQRLPVPVNELPHGWKAWGKSYFVRAAKTNNSFVVDGDTLKECPLKHRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECDPAVIGTAVKGKEAVHSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGIEESDLIIPKSLAGPLSHHNTREGYRTQMKGPWHSEELEIRFEECPGTKVHVEETCGTRGPSLRSTTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKEPESNLVRSMVTA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 58-150 93 151-352 1-40 41-57 40 201 slipknot
view details
2.1 83-153 71 154-352 1-70 71-82 70 198 slipknot
view details
3.1 86-255 170 1-82, 269-352 83-85, 256-268 82 84 slipknot
view details
3.1 86-268 183 1-82, 276-352 83-85, 269-275 82 77 slipknot
view details
3.1 87-259 173 1-85, 276-352 86-86, 260-275 85 77 slipknot
view details
3.1 87-340 254 341-352 1-82 83-86 82 11 slipknot
view details
3.1 90-180 91 181-352 1-82 83-89 82 171 slipknot
sequence length 352
structure length 352
publication title Contribution of intertwined loop to membrane association revealed by Zika virus full-length NS1 structure
pubmed doi rcsb
molecule tags Viral protein
molecule keywords NS1 of Zika virus from 2015 Brazil strain
source organism Zika virus
total genus Genus: 86
ec nomenclature
pdb deposition date 2016-08-14
KnotProt deposition date 2017-01-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling