| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 14-c-19-b-40-c-38 | 34-b-55 |
Chain Sequence |
QCVNATCERKLDALGNAVITKCPQGCLCVVRGASNIVPANGTCFQLA
|
| sequence length |
47
|
| structure length |
47
|
| publication title |
Structural basis for therapeutic inhibition of complement C5.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Complement C5
|
| source organism |
Ornithodoros moubata
|
| ec nomenclature | |
| pdb deposition date | 2016-01-04 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
