| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 50-c-54-b-97-c-95 | 19-b-61 |
Chain Sequence |
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
|
| sequence length |
95
|
| structure length |
95
|
| publication title |
A Potent d-Protein Antagonist of VEGF-A is Nonimmunogenic, Metabolically Stable, and Longer-Circulating in Vivo.
pubmed doi rcsb |
| molecule tags |
De novo protein
|
| molecule keywords |
Vascular endothelial growth factor A
|
| ec nomenclature | |
| pdb deposition date | 2016-01-10 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
