Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 78-141 | 64 | 1-77 | 146-159 | 142-145 | 77 | 14 | slipknot |
Chain Sequence |
RSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 79-139 | 61 | 1-78 | 148-159 | 140-147 | 78 | 12 | slipknot | ||
view details |
![]() |
1.1 | 84-140 | 57 | 1-78, 147-159 | 79-83, 141-146 | 78 | 13 | slipknot |
sequence length |
159
|
structure length |
159
|
publication title |
Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1 Receptor-Binding Pocket, Revealing a Target for Broadly Neutralizing Antibodies.
pubmed doi rcsb |
molecule tags |
Viral protein/immune system
|
molecule keywords |
Envelope glycoprotein
|
source organism |
Ebola virus sp.
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2016-01-12 |
KnotProt deposition date | 2016-03-15 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...