5HK5B

Structure of the grem2-gdf5 inhibitory complex
Cysteine knot
Loop Piercing
view details
48-c-52-b-119-c-117 19-b-85
Chain Sequence
KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
sequence length 105
structure length 105
publication title Structure of Gremlin-2 in Complex with GDF5 Gives Insight into DAN-Family-Mediated BMP Antagonism.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Gremlin-2
source organism Mus musculus
ec nomenclature
pdb deposition date 2016-01-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling