5HWXA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and zero ca2+
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 126
Knot K +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 44-229 186 1-43, 230-301 43 72 knot
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSA-------KNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 9x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 41-227 187 1-40, 228-299 40 72 knot
Fingerprint Knot forming loop Loop type
K +31 Met1 ... Ala47 <->
Bridging ionNa402
<-> Ser51 ...
Chain closureMet301 <-> Met1
 probabilistic
K +31 Met1 ... Ala47 <->
Bridging ionNa402
<-> Thr50 ...
Chain closureMet301 <-> Met1
 probabilistic
K +31 Thr50 <->
Bridging ionNa401
<-> Thr209 ... Glu213 <->
Bridging ionNa401
<-> Thr50		 ion-based
K +31 Thr50 ... Glu54 <->
Bridging ionNa401
<-> Thr209 ... Glu213 <->
Bridging ionNa401
<-> Thr50		 ion-based
K +31 Ser51 <->
Bridging ionNa402
<-> Ser236 ... Glu213 <->
Bridging ionNa401
<-> Thr209 ... Ser51		 ion-based
K +31 Met1 ... Glu54 <->
Bridging ionNa401
<-> Thr209 ... Glu213 <->
Bridging ionNa402
<-> Ser236 ...
Chain closureMet301 <-> Met1
 probabilistic
K +31 Met1 ... Ala47 <->
Bridging ionNa402
<-> Ser51 ... Thr209 <->
Bridging ionNa401
<-> Glu213 ...
Chain closureMet301 <-> Met1
 probabilistic
K +31 Met1 ... Thr50 <->
Bridging ionNa401
<-> Glu54 ...
Chain closureMet301 <-> Met1
 probabilistic
K +31 Thr50 ... Ser51 <->
Bridging ionNa402
<-> Glu213 ... Glu54 <->
Bridging ionNa401
<-> Thr50		 ion-based
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSA-------KNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 22-247 226 1-21, 248-301 21 54 knot
view details
3.1 42-236 195 237-301 1-5 6-41 5 64 slipknot
view details
2.1 48-242 195 243-301 1-41 42-47 41 58 slipknot
view details
2.1 51-249 199 250-301 1-47 48-50 47 51 slipknot
view details
2.1 53-265 213 1-50, 300-301 51-52, 266-299 50 2 slipknot
sequence length 301
structure length 294
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords sodium,calcium exchanger
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045 / nbrc 100440)
missing residues 149-155
total genus Genus: 126
ec nomenclature
pdb deposition date 2016-01-29
KnotProt deposition date 2018-10-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling