Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 44-230 | 187 | 1-43, 231-300 | 43 | 70 | knot |
Chain Sequence |
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAEIEENNDKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 2.1 | 21-248 | 228 | 1-20, 249-300 | 20 | 52 | knot | |||||
view details | 3.1 | 18-236 | 219 | 1-4, 249-300 | 5-17, 237-248 | 4 | 52 | slipknot | ||||
view details | 2.1 | 28-248 | 221 | 1-20, 281-300 | 21-27, 249-280 | 20 | 20 | slipknot | ||||
view details | 3.1 | 28-280 | 253 | 1-20, 285-300 | 21-27, 281-284 | 20 | 16 | slipknot | ||||
view details | 3.1 | 28-284 | 257 | 285-300 | 1-20 | 21-27 | 20 | 15 | slipknot | |||
view details | 2.1 | 38-244 | 207 | 245-300 | 1-17 | 18-37 | 17 | 55 | slipknot | |||
view details | 2.1 | 40-239 | 200 | 1-17, 269-300 | 18-39, 240-268 | 17 | 32 | slipknot | ||||
view details | 2.1 | 40-268 | 229 | 269-300 | 1-37 | 38-39 | 37 | 31 | slipknot | |||
view details | 2.1 | 44-244 | 201 | 245-300 | 1-39 | 40-43 | 39 | 55 | slipknot | |||
view details | 2.1 | 47-241 | 195 | 1-39, 269-300 | 40-46, 242-268 | 39 | 32 | slipknot | ||||
view details | 2.1 | 47-268 | 222 | 269-300 | 1-43 | 44-46 | 43 | 31 | slipknot |
sequence length |
300
|
structure length |
300
|
publication title |
Mechanism of extracellular ion exchange and binding-site occlusion in the sodium-calcium exchanger
doi rcsb |
molecule tags |
Membrane protein
|
molecule keywords |
Uncharacterized membrane protein MJ0091
|
source organism |
Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
|
total genus |
Genus: 133
|
ec nomenclature | |
pdb deposition date | 2016-01-29 |
KnotProt deposition date | 2016-05-22 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...