Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 37-c-41-b-109-c-107 | 8-b-74 |
Chain Sequence |
SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
|
sequence length |
105
|
structure length |
105
|
publication title |
Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
molecule keywords |
Maltose-binding periplasmic protein,Endoglin
|
source organism |
Escherichia coli k12
|
ec nomenclature | |
pdb deposition date | 2016-02-03 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...