5I2PA

Resonance assignments and nmr structure determination of tarantula toxin- w7a mutant of mu-trtx-pre1a (w6a in native sequence numbering)
Cysteine knot
Loop Piercing
view details
4-c-11-b-24-c-19 18-b-31
Chain Sequence
SEDCLGAFSRCSPKNDKCCPNYKCSSKDLWCKYKIW
sequence length 36
structure length 36
publication title Resonance assignments and NMR structure determination of tarantula toxin- W7A mutant of mu-TRTX-Pre1a
rcsb
molecule tags Toxin
molecule keywords W7A mu-TRTX-Pre1a Toxin
source organism Psalmopoeus
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling